PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_008589-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB_related
Protein Properties Length: 497aa    MW: 54691.2 Da    PI: 6.06
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_008589-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.7e-174690147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+eE++++++a k++G   W++I +++g ++t+ q++s+ qk+
  AHYPO_008589-RA 46 RERWTEEEHKRFLEALKLYGRA-WRKIEEHVG-TKTAVQIRSHAQKF 90
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.96E-174094IPR009057Homeodomain-like
PROSITE profilePS5129421.9044195IPR017930Myb domain
TIGRFAMsTIGR015572.6E-174493IPR006447Myb domain, plants
SMARTSM007172.9E-134593IPR001005SANT/Myb domain
PfamPF002493.3E-144689IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-94686IPR009057Homeodomain-like
CDDcd001672.17E-104891No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010600Biological Processregulation of auxin biosynthetic process
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    Send to blast
MAAQEENGGP ESNFVGEFTL ISGVQSVTGE SHVPKIRKPY TITKQRERWT EEEHKRFLEA  60
LKLYGRAWRK IEEHVGTKTA VQIRSHAQKF FSKVVRETSN SNSNSTEPIE IPPPRPKRKP  120
SHPYPRKLVL PSKKGMPMEQ RARSESPNSL LPEQENQSPT SVLSAVASDT LASVDSATPK  180
SSPSPVSSGN FADQVTVFPC EDNAPKPLQT TSASVKLELF PDKESSDKED VASTKVLKLF  240
GKDLVVPGNP SDSSSSLSKS PSSDMGRVVQ AYPEDSKPTV LDNQTSFSMN KSTNVEKPVP  300
LPWWVFRGFD IPSCGDPQEK ETQREGSSAD SSSDSVNGEQ MLEKNWDAET ESGLCAQSSD  360
KESKTSANSS PEKEPTLFEK RTSIDNGRKG FVPYKRCLSE RDMQSSTITS EDRENQRIRL  420
CLLKTQFSIH ETMTNQYSST CNSVAILAAT SLENEAIDGG CVDMANRKPR TLGLVFLGVL  480
FILLYLLPFV VGVSEL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00515DAPTransfer from AT5G17300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010675239.10.0PREDICTED: protein REVEILLE 2 isoform X1
TrEMBLA0A0J8CMR10.0A0A0J8CMR1_BETVU; Uncharacterized protein
STRINGVIT_04s0079g00410.t011e-96(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.13e-55MYB_related family protein